Recombinant Full Length Human METTL6 Protein, GST-tagged

• Cat.No.: METTL6-6175HF
• Product Overview: Human METTL6 full-length ORF ( AAH22400.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 255 amino acids
• Description: METTL6 (Methyltransferase Like 6) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity. An important paralog of this gene is METTL2B.
• Molecular Mass: 56.5 kDa
• AA Sequence: MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL6 methyltransferase like 6 [ Homo sapiens ]
• Official Symbol: METTL6
• Synonyms: METTL6; methyltransferase like 6; methyltransferase-like protein 6; MGC24132
• Gene ID: 131965
• mRNA Refseq: NM_152396
• Protein Refseq: NP_689609
• MIM: 618903
• UniProt ID: Q8TCB7