Recombinant Human METTL21C Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : METTL21C-3648H
Product Overview : C13orf39 MS Standard C13 and N15-labeled recombinant protein (NP_001010977) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : METTL21C (Methyltransferase Like 21C) is a Protein Coding gene. Diseases associated with METTL21C include Chromosome 4Q21 Deletion Syndrome and Waardenburg Syndrome, Type 3. Gene Ontology (GO) annotations related to this gene include protein-lysine N-methyltransferase activity. An important paralog of this gene is EEF1AKMT3.
Molecular Mass : 29.6 kDa
AA Sequence : MDVCLSSAQQPGRRGEGLSSPGGWLEAEKKGAPQKDSTGGVLEESNKIEPSLHSLQKFVPTDYASYTQEHYRFAGKEIVIQESIESYGAVVWPGAMALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPESSVKLFKGILKWDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name METTL21C methyltransferase like 21C [ Homo sapiens (human) ]
Official Symbol METTL21C
Synonyms METTL21C; methyltransferase like 21C; C13orf39, chromosome 13 open reading frame 39; methyltransferase-like protein 21C; LOC196541; C13orf39;
Gene ID 196541
mRNA Refseq NM_001010977
Protein Refseq NP_001010977
MIM 615259
UniProt ID Q5VZV1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All METTL21C Products

Required fields are marked with *

My Review for All METTL21C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon