Recombinant Human METTL21C Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: METTL21C-3648H
• Product Overview: C13orf39 MS Standard C13 and N15-labeled recombinant protein (NP_001010977) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: METTL21C (Methyltransferase Like 21C) is a Protein Coding gene. Diseases associated with METTL21C include Chromosome 4Q21 Deletion Syndrome and Waardenburg Syndrome, Type 3. Gene Ontology (GO) annotations related to this gene include protein-lysine N-methyltransferase activity. An important paralog of this gene is EEF1AKMT3.
• Molecular Mass: 29.6 kDa
• AA Sequence: MDVCLSSAQQPGRRGEGLSSPGGWLEAEKKGAPQKDSTGGVLEESNKIEPSLHSLQKFVPTDYASYTQEHYRFAGKEIVIQESIESYGAVVWPGAMALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPESSVKLFKGILKWDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: METTL21C methyltransferase like 21C [ Homo sapiens (human) ]
• Official Symbol: METTL21C
• Synonyms: METTL21C; methyltransferase like 21C; C13orf39, chromosome 13 open reading frame 39; methyltransferase-like protein 21C; LOC196541; C13orf39
• Gene ID: 196541
• mRNA Refseq: NM_001010977
• Protein Refseq: NP_001010977
• MIM: 615259
• UniProt ID: Q5VZV1