Recombinant Human METAP2 protein(51-190 aa), C-His-tagged

• Cat.No.: METAP2-2780H
• Product Overview: Recombinant Human METAP2 protein(P50579)(51-190 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 51-190 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AGEQEPDKESGASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPG

Gene Information

• Gene Name: METAP2 methionyl aminopeptidase 2 [ Homo sapiens ]
• Official Symbol: METAP2
• Synonyms: METAP2; methionyl aminopeptidase 2; methionine aminopeptidase 2; MAP2; MNPEP; p67; Peptidase M; MAP 2; metAP 2; peptidase M 2; eIF-2-associated p67 homolog; initiation factor 2-associated 67 kDa glycoprotein; p67eIF2
• Gene ID: 10988
• mRNA Refseq: NM_006838
• Protein Refseq: NP_006829
• MIM: 601870
• UniProt ID: P50579