Recombinant Human MEF2C
Cat.No. : | MEF2C-29558TH |
Product Overview : | Recombinant full length Human MEF2C with N terminal proprietary tag, 77.66kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
ProteinLength : | 469 amino acids |
Description : | This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe mental retardation, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described. |
Molecular Weight : | 77.660kDa inclusive of tags |
Tissue specificity : | Expressed in brain and skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCD CEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEQHES RTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYR KINEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLV YSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNT GGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNK NMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDV DLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYP SAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQ QHLHNMQPSALSQLGACTSTHLSQSSNLSLPSTQSLNI KSEPVSPPRDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSS YDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLS E |
Sequence Similarities : | Belongs to the MEF2 family.Contains 1 MADS-box domain.Contains 1 Mef2-type DNA-binding domain. |
Gene Name | MEF2C myocyte enhancer factor 2C [ Homo sapiens ] |
Official Symbol | MEF2C |
Synonyms | MEF2C; myocyte enhancer factor 2C; myocyte-specific enhancer factor 2C; |
Gene ID | 4208 |
mRNA Refseq | NM_001131005 |
Protein Refseq | NP_001124477 |
MIM | 600662 |
Uniprot ID | Q06413 |
Chromosome Location | 5q14 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Adipogenesis, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function | AT DNA binding; DNA binding; DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; RNA polymerase II core promoter sequence-specific DNA b; |
◆ Recombinant Proteins | ||
YISJ-2403B | Recombinant Bacillus subtilis YISJ protein, His-tagged | +Inquiry |
KIAA1409-2217R | Recombinant Rhesus Macaque KIAA1409 Protein, His (Fc)-Avi-tagged | +Inquiry |
Il1b-390C | Active Recombinant Cotton Rat Il1b, Met-tagged | +Inquiry |
G2E3-2115C | Recombinant Chicken G2E3 | +Inquiry |
C5orf51-2677HF | Recombinant Full Length Human C5orf51 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
VZV-04 | Native Varicella Zoster Virus (VZV) Antigen | +Inquiry |
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
PLG-27842TH | Native Human PLG | +Inquiry |
GS-32 | Active Native Glutamine synthetase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF764-13HCL | Recombinant Human ZNF764 293 Cell Lysate | +Inquiry |
LINC00174-4694HCL | Recombinant Human LOC285908 293 Cell Lysate | +Inquiry |
KIAA1143-4968HCL | Recombinant Human KIAA1143 293 Cell Lysate | +Inquiry |
PLAU-1734HCL | Recombinant Human PLAU cell lysate | +Inquiry |
THUMPD3-1083HCL | Recombinant Human THUMPD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEF2C Products
Required fields are marked with *
My Review for All MEF2C Products
Required fields are marked with *
0
Inquiry Basket