Recombinant Human MED26 Protein, GST-tagged

• Cat.No.: MED26-1908H
• Product Overview: Human CRSP7 partial ORF ( NP_004822, 501 a.a. - 600 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: GAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MED26 mediator complex subunit 26 [ Homo sapiens ]
• Official Symbol: MED26
• Synonyms: MED26; mediator complex subunit 26; cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa , CRSP7; mediator of RNA polymerase II transcription subunit 26; CRSP70; ARC70; CRSP complex subunit 7; transcriptional coactivator CRSP70; activator-recruited cofactor 70 kDa component; cofactor required for Sp1 transcriptional activation subunit 7; cofactor required for Sp1 transcriptional activation, subunit 7 (70kD); cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa; CRSP7
• Gene ID: 9441
• mRNA Refseq: NM_004831
• Protein Refseq: NP_004822
• MIM: 605043
• UniProt ID: O95402