Recombinant Human MED16, His-tagged

Cat.No. : MED16-31175TH
Product Overview : Recombinant fragment, corresponding to amino acids 663-751 of Human THRAP5 isoform 4 with N terminal His tag; 89 amino acids, 25kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 663-751 a.a.
Description : Mediator of RNA polymerase II transcription subunit 16 is an enzyme that in humans is encoded by the MED16 gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 88 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PAWTGCQPATAWLAACSPSSPFVCSLAGRPRCLAVLPPCS STASPGPQASPRSTTCGGCTLALAPRRNARPAPGAAVS PCSSRPTEPRR
Gene Name MED16 mediator complex subunit 16 [ Homo sapiens ]
Official Symbol MED16
Synonyms MED16; mediator complex subunit 16; THRAP5, thyroid hormone receptor associated protein 5; mediator of RNA polymerase II transcription subunit 16; DRIP92; TRAP95;
Gene ID 10025
mRNA Refseq NM_005481
Protein Refseq NP_005472
MIM 604062
Uniprot ID Q9Y2X0
Chromosome Location 19p13.3
Pathway Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem;
Function receptor activity; thyroid hormone receptor binding; thyroid hormone receptor coactivator activity; transcription coactivator activity; transcription cofactor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MED16 Products

Required fields are marked with *

My Review for All MED16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon