Recombinant Human MED11 Protein, GST-tagged

• Cat.No.: MED11-4480H
• Product Overview: Human MED11 full-length ORF (AAH70377.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MED11 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]).[supplied by OMIM
• Molecular Mass: 39.5 kDa
• AA Sequence: MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MED11 mediator complex subunit 11 [ Homo sapiens (human) ]
• Official Symbol: MED11
• Synonyms: MED11; mediator complex subunit 11; HSPC296; mediator of RNA polymerase II transcription subunit 11; mediator of RNA polymerase II transcription, subunit 11 homolog
• Gene ID: https://www.ncbi.nlm.nih.gov/gene/?term=400569
• mRNA Refseq: NM_001001683
• Protein Refseq: NP_001001683
• MIM: 612383
• UniProt ID: Q9P086