Recombinant Human ME2 Protein, C-6×His tagged

• Cat.No.: ME2-19H
• Product Overview: Recombinant Human ME2 Protein with C-6×His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Enables cytokine activity and growth factor activity. Acts upstream of or within several processes, including animal organ development; generation of neurons; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; cranium; early conceptus; and female reproductive system. Orthologous to human LIF (LIF interleukin 6 family cytokine).
• Molecular Mass: 64.4 KD
• AA Sequence: MIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITELEHHHHHH
• Purity: > 95% by SDS-PAGE
• Usage: Protein binding assay, small molecule inhibitor screening, substrate of kinase, antigen, ELISA, Western blot, crystallization and co- crystallization studies.
• Storage: Upon delivery aliquot and store at -80 centigrade. Avoid multiple freeze-thaw cycles. The protein is stable for 12 months at -80 centigrade, for 2-4 weeks at 4 centigrade.
• Storage Buffer: 30 mM Tris pH 7.4; 500 mM NaCl; 10% glycerol; 3 mM MgCl2; 5 mM beta-mercaptoethanol; 1 mM PMSF; 1 mM Benzamidine
• Reconstitution: Clear solution in 30 mM Tris, pH7.4, 150 mM NaCl, 40% Glycerol, 5 mM DTT

Gene Information

• Gene Name: ME2 malic enzyme 2, NAD(+)-dependent, mitochondrial [ Homo sapiens (human) ]
• Official Symbol: ME2
• Synonyms: ME2; malic enzyme 2, NAD(+)-dependent, mitochondrial; NAD-dependent malic enzyme, mitochondrial; NAD-ME; malate dehydrogenase; pyruvic-malic carboxylase; ODS1
• Gene ID: 4200
• mRNA Refseq: NM_001168335
• Protein Refseq: NP_001161807
• MIM: 154270
• UniProt ID: P23368