Recombinant Full Length Human ME2 Protein, C-Flag-tagged
Cat.No. : | ME2-198HFL |
Product Overview : | Recombinant Full Length Human ME2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, that catalyzes the oxidative decarboxylation of malate to pyruvate. It had previously been weakly linked to a syndrome known as Friedreich ataxia that has since been shown to be the result of mutation in a completely different gene. Certain single-nucleotide polymorphism haplotypes of this gene have been shown to increase the risk for idiopathic generalized epilepsy. Alternatively spliced transcript variants encoding different isoforms found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.4 kDa |
AA Sequence : | MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHR NLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDR GHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNI ALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDI QGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLL VKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALS NPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSV FLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRS EYDSLLPDVYEWPESASSPPVITETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Pyruvate metabolism |
Full Length : | Full L. |
Gene Name | ME2 malic enzyme 2 [ Homo sapiens (human) ] |
Official Symbol | ME2 |
Synonyms | ODS1 |
Gene ID | 4200 |
mRNA Refseq | NM_002396.5 |
Protein Refseq | NP_002387.1 |
MIM | 154270 |
UniProt ID | P23368 |
◆ Recombinant Proteins | ||
ME2-1052Z | Recombinant Zebrafish ME2 | +Inquiry |
ME2-6120HF | Recombinant Full Length Human ME2 Protein, GST-tagged | +Inquiry |
ME2-9672M | Recombinant Mouse ME2 Protein | +Inquiry |
ME2-2864H | Recombinant Human ME2 protein, His-tagged | +Inquiry |
ME2-4529H | Recombinant Human ME2 Protein (Gly220-Ala426), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ME2-4400HCL | Recombinant Human ME2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ME2 Products
Required fields are marked with *
My Review for All ME2 Products
Required fields are marked with *
0
Inquiry Basket