Recombinant Human MCM9 Protein, GST-tagged

• Cat.No.: MCM9-4514H
• Product Overview: Human MCMDC1 partial ORF ( AAH31658, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication. [provided by RefSeq
• Molecular Mass: 36.41 kDa
• AA Sequence: MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQNLHARI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MCM9 minichromosome maintenance complex component 9 [ Homo sapiens ]
• Official Symbol: MCM9
• Synonyms: MCM9; minichromosome maintenance complex component 9; C6orf61, chromosome 6 open reading frame 61 , MCMDC1, minichromosome maintenance deficient domain containing 1; DNA replication licensing factor MCM9; dJ329L24.3; FLJ20170; MGC35304; minichromosome maintenance deficient domain containing 1; mini-chromosome maintenance deficient domain-containing protein 1; MCMDC1; C6orf61; dJ329L24.1; FLJ13942; FLJ56845
• Gene ID: 254394
• mRNA Refseq: NM_017696
• Protein Refseq: NP_060166
• MIM: 610098
• UniProt ID: Q9NXL9