Recombinant Human MCM5, His-tagged
Cat.No. : | MCM5-28041TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 217-734 of Human MCM5 with N terminal His tag; 518 amino acids, 63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 217-734 a.a. |
Description : | The protein encoded by this gene is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 57 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDK VVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYI RVLGIQVDTDGSGRSFAGAVSPQEEEEFRRLAALPNVY EVISKSIAPSIFGGTDMKKAIACLLFGGSRKRLPDGLTRR GDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSS AAGLTASVMRDPSSRNFIMEGGAMVLADGGVVCIDEFD KMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAA NSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNE ERDVMLAKHVITLHVSALTQTQAVEGEIDLAKLKKFIA YCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDR RSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALR LFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLK RRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRR GEIQHRMQRKVLYRLK |
Sequence Similarities : | Belongs to the MCM family.Contains 1 MCM domain. |
Gene Name | MCM5 minichromosome maintenance complex component 5 [ Homo sapiens ] |
Official Symbol | MCM5 |
Synonyms | MCM5; minichromosome maintenance complex component 5; CDC46, MCM5 minichromosome maintenance deficient 5, cell division cycle 46 (S. cerevisiae) , minichromosome maintenance deficient (S. cerevisiae) 5 (cell division cycle 46); DNA replication licensing |
Gene ID | 4174 |
mRNA Refseq | NM_006739 |
Protein Refseq | NP_006730 |
MIM | 602696 |
Uniprot ID | P33992 |
Chromosome Location | 22q13.1-q13.2 |
Pathway | Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
Function | ATP binding; DNA binding; helicase activity; hydrolase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
CCDC114-4000H | Recombinant Human CCDC114 protein, His-tagged | +Inquiry |
NCL-07H | Recombinant Human NCL protein, His-tagged | +Inquiry |
ARSG-2552H | Recombinant Human ARSG protein, His-SUMO-tagged | +Inquiry |
CHAC2-1200H | Recombinant Human CHAC2 Protein, GST-Tagged | +Inquiry |
Cpb1-768M | Active Recombinant Mouse Cpb1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgE-01M | Native Mouse IgE protein | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
Clostripain-01C | Native Clostridium histolyticum Clostripain | +Inquiry |
ighg1-160M | Native Mouse Immunoglobulin G1 | +Inquiry |
Collagen-326H | Native Human Collagen Type III | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLH-1392HCL | Recombinant Human POLH cell lysate | +Inquiry |
SERPINA6-1948HCL | Recombinant Human SERPINA6 cell lysate | +Inquiry |
SELP-972MCL | Recombinant Mouse SELP cell lysate | +Inquiry |
GPR171-305HCL | Recombinant Human GPR171 lysate | +Inquiry |
SkeletalMuscles-441S | Sheep Skeletal Muscles Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MCM5 Products
Required fields are marked with *
My Review for All MCM5 Products
Required fields are marked with *
0
Inquiry Basket