Recombinant Human MCM3, His-tagged
Cat.No. : | MCM3-28038TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 182-808 of Human MCM3 with an N-terminal His tag; Predicted MWt 71kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 182-808 a.a. |
Description : | The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 84 μl aqua dest |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVIL DDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTV LIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFD QLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHI RGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSG VGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDK MSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAA ANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQM DPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILAT DDPNFSQEDQQDTQIYEKHDNLLHGTKKKKEKMVSAAF MKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQDSMSS DTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAE EAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVH TPKTADSQETKESQKVELSESRLKAFKVALLDVFREAH AQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQ VMVSEGIIFLI |
Sequence Similarities : | Belongs to the MCM family.Contains 1 MCM domain. |
Gene Name | MCM3 minichromosome maintenance complex component 3 [ Homo sapiens ] |
Official Symbol | MCM3 |
Synonyms | MCM3; minichromosome maintenance complex component 3; MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) , minichromosome maintenance deficient (S. cerevisiae) 3; DNA replication licensing factor MCM3; |
Gene ID | 4172 |
mRNA Refseq | NM_002388 |
Protein Refseq | NP_002379 |
MIM | 602693 |
Uniprot ID | P25205 |
Chromosome Location | 6p12 |
Pathway | Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
Function | ATP binding; DNA binding; helicase activity; hydrolase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
SFTPB-2223H | Recombinant Human SFTPB Protein (201-279 aa) | +Inquiry |
Ephb1-911M | Recombinant Mouse Ephb1 protein(Met591-Ala984), His&GST-tagged | +Inquiry |
CD226-634HAF488 | Recombinant Human CD226 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
GIPC2-4915H | Recombinant Human GIPC2 Protein, GST-tagged | +Inquiry |
HIST2H3A-4812H | Recombinant Human HIST2H3A Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
Lectin-1748B | Active Native Bauhinia Purpurea Lectin Protein | +Inquiry |
IgG-343M | Native MONKEY IgG | +Inquiry |
IgG-224M | Native Mouse Immunoglobulin G | +Inquiry |
Acetate Kinase-22B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM151A-6423HCL | Recombinant Human FAM151A 293 Cell Lysate | +Inquiry |
LILRB4-380HCL | Recombinant Human LILRB4 lysate | +Inquiry |
NCK1-3947HCL | Recombinant Human NCK1 293 Cell Lysate | +Inquiry |
PPP2R2C-1403HCL | Recombinant Human PPP2R2C cell lysate | +Inquiry |
TECTB-661HCL | Recombinant Human TECTB lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MCM3 Products
Required fields are marked with *
My Review for All MCM3 Products
Required fields are marked with *
0
Inquiry Basket