Recombinant Human MBD2 protein(143-411aa), His-KSI-tagged

• Cat.No.: MBD2-4938H
• Product Overview: Recombinant Human MBD2 protein(Q9UBB5)(143-411aa), fused with N-terminal His and KSI tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His-KSI
• Protein length: 143-411aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 45.2 kDa
• AASequence: ATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: MBD2 methyl-CpG binding domain protein 2 [ Homo sapiens ]
• Official Symbol: MBD2
• Synonyms: MBD2; methyl-CpG binding domain protein 2; methyl-CpG-binding domain protein 2; demethylase; DMTase; NY-CO-41; DKFZp586O0821
• Gene ID: 8932
• mRNA Refseq: NM_003927
• Protein Refseq: NP_003918
• MIM: 603547
• UniProt ID: Q9UBB5