Recombinant Human MAT2B protein, His-tagged

• Cat.No.: MAT2B-3526H
• Product Overview: Recombinant Human MAT2B protein(1-323 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-323 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNTQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MAT2B methionine adenosyltransferase II, beta [ Homo sapiens ]
• Official Symbol: MAT2B
• Synonyms: MAT2B; methionine adenosyltransferase II, beta; methionine adenosyltransferase 2 subunit beta; MATIIbeta; SDR23E1; short chain dehydrogenase/reductase family 23E; member 1; MAT II beta; putative protein product of Nbla02999; dTDP-4-keto-6-deoxy-D-glucose 4-reductase; putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase; short chain dehydrogenase/reductase family 23E, member 1; beta regulatory subunit of methionine adenosyltransferase; TGR; MAT-II; Nbla02999; MGC12237
• Gene ID: 27430
• mRNA Refseq: NM_013283
• Protein Refseq: NP_037415
• MIM: 605527
• UniProt ID: Q9NZL9