Recombinant Human MARK2 protein, His-tagged

• Cat.No.: MARK2-3525H
• Product Overview: Recombinant Human MARK2 protein(10-372 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 10-372 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: LNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSELEGDTI
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MARK2 MAP/microtubule affinity-regulating kinase 2 [ Homo sapiens ]
• Official Symbol: MARK2
• Synonyms: MARK2; MAP/microtubule affinity-regulating kinase 2; ELKL motif kinase , EMK1; serine/threonine-protein kinase MARK2; ELKL motif kinase 1; PAR 1; Par1b; protein serine/threonine kinase; Ser/Thr protein kinase PAR 1B; serine/threonine kinase; PAR1 homolog b; Ser/Thr protein kinase PAR-1B; serine/threonine protein kinase EMK; EMK1; EMK-1; PAR-1; Par-1b; MGC99619
• Gene ID: 2011
• mRNA Refseq: NM_001039469
• Protein Refseq: NP_001034558
• MIM: 600526
• UniProt ID: Q7KZI7