Recombinant Human MARCKSL1 protein, GST-tagged

• Cat.No.: MARCKSL1-3208H
• Product Overview: Recombinant Human MARCKSL1 protein(P49006)(1-195aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-195aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 46.5 kDa
• AA Sequence: MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: MARCKSL1 MARCKS-like 1 [ Homo sapiens ]
• Official Symbol: MARCKSL1
• Synonyms: MARCKSL1; MARCKS-like 1; MARCKS like protein , MLP; MARCKS-related protein; F52; MacMARCKS; MLP1; mac-MARCKS; MARCKS-like protein 1; macrophage myristoylated alanine-rich C kinase substrate; MLP; MRP; MACMARCKS
• Gene ID: 65108
• mRNA Refseq: NM_023009
• Protein Refseq: NP_075385
• MIM: 602940
• UniProt ID: P49006