Recombinant Human MAPK8IP2, His-tagged
Cat.No. : | MAPK8IP2-29843TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 569-797 of Human JIP2 with an N terminal His tag. Observed mwt: 30 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 569-797 a.a. |
Description : | The protein encoded by this gene is closely related to MAPK8IP1/IB1/JIP-1, a scaffold protein that is involved in the c-Jun amino-terminal kinase signaling pathway. This protein is expressed in brain and pancreatic cells. It has been shown to interact with, and regulate the activity of MAPK8/JNK1, and MAP2K7/MKK7 kinases. This protein thus is thought to function as a regulator of signal transduction by protein kinase cascade in brain and pancreatic beta-cells. Alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene. |
Conjugation : | HIS |
Tissue specificity : | Expressed mainly in the brain and pancreas, including insulin-secreting cells. In the nervous system, more abundantly expressed in the cerebellum, pituitary gland, occipital lobe and the amygdala. Also expressed in fetal brain. Very low levels found in ut |
Form : | Lyophilised:Reconstitute with 142 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FSCLVNGEEREQTHRAVFRFIPRHPDELELDVDDPVLVEA EEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDLLGS KRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATAR KLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHF FQMKNISFCGCHPRNSCYFGFITKHPLLSRFACHVFVS QESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE |
Sequence Similarities : | Belongs to the JIP scaffold family.Contains 1 PID domain.Contains 1 SH3 domain. |
Gene Name | MAPK8IP2 mitogen-activated protein kinase 8 interacting protein 2 [ Homo sapiens ] |
Official Symbol | MAPK8IP2 |
Synonyms | MAPK8IP2; mitogen-activated protein kinase 8 interacting protein 2; PRKM8 interacting protein like , PRKM8IPL; C-Jun-amino-terminal kinase-interacting protein 2; IB2; islet brain 2; JIP2; JNK interacting protein 2; |
Gene ID | 23542 |
mRNA Refseq | NM_012324 |
Protein Refseq | NP_036456 |
MIM | 607755 |
Uniprot ID | Q13387 |
Chromosome Location | 22q13.33 |
Pathway | MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; |
Function | MAP-kinase scaffold activity; beta-amyloid binding; kinesin binding; protein complex binding; protein kinase activator activity; |
◆ Recombinant Proteins | ||
MAPK8IP2-301565H | Recombinant Human MAPK8IP2 protein, GST-tagged | +Inquiry |
MAPK8IP2-6302H | Recombinant Human MAPK8IP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAPK8IP2-384H | Recombinant Human MAPK8IP2 Protein, MYC/DDK-tagged | +Inquiry |
Mapk8ip2-3947M | Recombinant Mouse Mapk8ip2 Protein, Myc/DDK-tagged | +Inquiry |
MAPK8IP2-29843TH | Recombinant Human MAPK8IP2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK8IP2-402HCL | Recombinant Human MAPK8IP2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAPK8IP2 Products
Required fields are marked with *
My Review for All MAPK8IP2 Products
Required fields are marked with *
0
Inquiry Basket