Recombinant Human MAPK8IP2, His-tagged

• Cat.No.: MAPK8IP2-29843TH
• Product Overview: Recombinant fragment, corresponding to amino acids 569-797 of Human JIP2 with an N terminal His tag. Observed mwt: 30 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 569-797 a.a.
• Description: The protein encoded by this gene is closely related to MAPK8IP1/IB1/JIP-1, a scaffold protein that is involved in the c-Jun amino-terminal kinase signaling pathway. This protein is expressed in brain and pancreatic cells. It has been shown to interact with, and regulate the activity of MAPK8/JNK1, and MAP2K7/MKK7 kinases. This protein thus is thought to function as a regulator of signal transduction by protein kinase cascade in brain and pancreatic beta-cells. Alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene.
• Conjugation: HIS
• Tissue specificity: Expressed mainly in the brain and pancreas, including insulin-secreting cells. In the nervous system, more abundantly expressed in the cerebellum, pituitary gland, occipital lobe and the amygdala. Also expressed in fetal brain. Very low levels found in ut
• Form: Lyophilised:Reconstitute with 142 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FSCLVNGEEREQTHRAVFRFIPRHPDELELDVDDPVLVEA EEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDLLGS KRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATAR KLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHF FQMKNISFCGCHPRNSCYFGFITKHPLLSRFACHVFVS QESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE
• Sequence Similarities: Belongs to the JIP scaffold family.Contains 1 PID domain.Contains 1 SH3 domain.

Gene Information

• Gene Name: MAPK8IP2 mitogen-activated protein kinase 8 interacting protein 2 [ Homo sapiens ]
• Official Symbol: MAPK8IP2
• Synonyms: MAPK8IP2; mitogen-activated protein kinase 8 interacting protein 2; PRKM8 interacting protein like , PRKM8IPL; C-Jun-amino-terminal kinase-interacting protein 2; IB2; islet brain 2; JIP2; JNK interacting protein 2
• Gene ID: 23542
• mRNA Refseq: NM_012324
• Protein Refseq: NP_036456
• MIM: 607755
• Uniprot ID: Q13387
• Chromosome Location: 22q13.33
• Pathway: MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem
• Function: MAP-kinase scaffold activity; beta-amyloid binding; kinesin binding; protein complex binding; protein kinase activator activity