Recombinant Human MAPK13, His-tagged
Cat.No. : | MAPK13-31379TH |
Product Overview : | Recombinant full length Human SAPK4 with an N terminal His tag; 385 amino acids with tag, Predicted MWt 44.2 kDa. |
Availability | April 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 365 amino acids |
Description : | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase. |
Conjugation : | HIS |
Molecular Weight : | 44.200kDa inclusive of tags |
Tissue specificity : | Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL |
Sequence Similarities : | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.Contains 1 protein kinase domain. |
Gene Name | MAPK13 mitogen-activated protein kinase 13 [ Homo sapiens ] |
Official Symbol | MAPK13 |
Synonyms | MAPK13; mitogen-activated protein kinase 13; PRKM13; p38delta; SAPK4; |
Gene ID | 5603 |
mRNA Refseq | NM_002754 |
Protein Refseq | NP_002745 |
MIM | 602899 |
Uniprot ID | O15264 |
Chromosome Location | 6p21 |
Pathway | Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Cell-Cell communication, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; |
Function | ATP binding; MAP kinase activity; MAP kinase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
MAPK13-4999H | Recombinant Human MAPK13 Protein (Tyr25-Phe308), N-His tagged | +Inquiry |
MAPK13-48H | Recombinant Human MAPK13, GST-tagged | +Inquiry |
MAPK13-31H | Recombinant human biotinylated MAPK13, His-tagged | +Inquiry |
MAPK13-357H | Active Recombinant Human MAPK13 protein, GST-tagged | +Inquiry |
MAPK13-1089H | Recombinant Human MAPK13 Protein (S2-L365), GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK13-574HCL | Recombinant Human MAPK13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAPK13 Products
Required fields are marked with *
My Review for All MAPK13 Products
Required fields are marked with *
0
Inquiry Basket