Recombinant Human MAP3K3 protein, His-tagged
Cat.No. : | MAP3K3-2492H |
Product Overview : | Recombinant Human MAP3K3 protein(281-366 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 281-366 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MAP3K3 mitogen-activated protein kinase kinase kinase 3 [ Homo sapiens ] |
Official Symbol | MAP3K3 |
Synonyms | MAP3K3; mitogen-activated protein kinase kinase kinase 3; MEKK3; MAP/ERK kinase kinase 3; MAPK/ERK kinase kinase 3; MAPKKK3; MEKK 3; MEK kinase 3; |
Gene ID | 4215 |
mRNA Refseq | NM_002401 |
Protein Refseq | NP_002392 |
MIM | 602539 |
UniProt ID | Q99759 |
◆ Recombinant Proteins | ||
MAP3K3-9152HF | Active Recombinant Full Length Human MAP3K3 Protein, GST-tagged | +Inquiry |
MAP3K3-1259H | Recombinant Human Mitogen-Activated Protein Kinase Kinase Kinase 3, GST-tagged | +Inquiry |
MAP3K3-2489R | Recombinant Rhesus Macaque MAP3K3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP3K3-2669R | Recombinant Rhesus monkey MAP3K3 Protein, His-tagged | +Inquiry |
MAP3K3-30192TH | Recombinant Human MAP3K3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP3K3-4505HCL | Recombinant Human MAP3K3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAP3K3 Products
Required fields are marked with *
My Review for All MAP3K3 Products
Required fields are marked with *
0
Inquiry Basket