Recombinant Human MAP3K13 protein, GST-tagged

• Cat.No.: MAP3K13-3713H
• Product Overview: Recombinant Human MAP3K13 protein(706 - 839 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 706 - 839 aa
• AA Sequence: DCWRSSEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQKSGDDSSEEEEGEVDSEVEFPRRQRPHRCI
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MAP3K13 mitogen-activated protein kinase kinase kinase 13 [ Homo sapiens ]
• Official Symbol: MAP3K13
• Synonyms: MAP3K13; mitogen-activated protein kinase kinase kinase 13; leucine zipper bearing kinase; LZK; MEKK13; mixed lineage kinase; leucine zipper-bearing kinase; MLK; MGC133196
• Gene ID: 9175
• mRNA Refseq: NM_001242314
• Protein Refseq: NP_001229243
• MIM: 604915
• UniProt ID: O43283