Recombinant Human MAP3K10

• Cat.No.: MAP3K10-30247TH
• Product Overview: Recombinant fragment: FPRLPDPQAL FPARRRPPEF PGRPTTLTFA PRPRPAASRP RLDPWKLVSF GRTLTISPPS RPDTPESPGP PSVQPTLLDM DMEGQNQDST VPLCGAHGSH of Human MLK2 (amino acids 855-954) with N terminal proprietary tag, 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase has been shown to activate MAPK8/JNK and MKK4/SEK1, and this kinase itself can be phoshorylated, and thus activated by JNK kinases. This kinase functions preferentially on the JNK signaling pathway, and is reported to be involved in nerve growth factor (NGF) induced neuronal apoptosis.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed in brain and skeletal muscle.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FPRLPDPQALFPARRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWKLVSFGRTLTISPPSRPDTPESPGPPSVQPTLLDMDMEGQNQDSTVPLCGAHGSH
• Sequence Similarities: Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.Contains 1 protein kinase domain.Contains 1 SH3 domain.

Gene Information

• Gene Name: MAP3K10 mitogen-activated protein kinase kinase kinase 10 [ Homo sapiens ]
• Official Symbol: MAP3K10
• Synonyms: MAP3K10; mitogen-activated protein kinase kinase kinase 10; MLK2; MEKK10; mixed lineage kinase 2; MKN28 derived nonreceptor_type serine/threonine kinase; MKN28 kinase; MST
• Gene ID: 4294
• mRNA Refseq: NM_002446
• Protein Refseq: NP_002437
• MIM: 600137
• Uniprot ID: Q02779
• Chromosome Location: 19q13.2
• Pathway: Insulin Signaling, organism-specific biosystem; p38 MAPK signaling pathway, organism-specific biosystem
• Function: ATP binding; JUN kinase kinase kinase activity; bHLH transcription factor binding; nucleotide binding; protein homodimerization activity