Recombinant Human MALSU1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MALSU1-964H
• Product Overview: C7orf30 MS Standard C13 and N15-labeled recombinant protein (NP_612455) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: MALSU1 (Mitochondrial Assembly Of Ribosomal Large Subunit 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include ribosomal large subunit binding.
• Molecular Mass: 26.2 kDa
• AA Sequence: MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MALSU1 mitochondrial assembly of ribosomal large subunit 1 [ Homo sapiens (human) ]
• Official Symbol: MALSU1
• Synonyms: MALSU1; mitochondrial assembly of ribosomal large subunit 1; mtRsfA; C7orf30; mitochondrial assembly of ribosomal large subunit protein 1
• Gene ID: 115416
• mRNA Refseq: NM_138446
• Protein Refseq: NP_612455
• MIM: 614624
• UniProt ID: Q96EH3