Recombinant Human MALSU1 Protein, GST-tagged

• Cat.No.: MALSU1-5211H
• Product Overview: Human C7orf30 full-length ORF ( NP_612455.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MALSU1 (Mitochondrial Assembly Of Ribosomal Large Subunit 1) is a Protein Coding gene. GO annotations related to this gene include ribosomal large subunit binding.
• Molecular Mass: 52.6 kDa
• AA Sequence: MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MALSU1 mitochondrial assembly of ribosomal large subunit 1 [ Homo sapiens (human) ]
• Official Symbol: MALSU1
• Synonyms: C7orf30; MALSU1; mitochondrial assembly of ribosomal large subunit 1; mtRsfA; mitochondrial assembly of ribosomal large subunit protein 1
• Gene ID: 115416
• mRNA Refseq: NM_138446
• Protein Refseq: NP_612455
• MIM: 614624
• UniProt ID: Q96EH3