Recombinant Human MAGEA6 protein, T7/His-tagged
Cat.No. : | MAGEA6-232H |
Product Overview : | Recombinant human MAGEA6 cDNA (2 – 314 aa, which derived from BC067731) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 2-314 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVE VTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFLLL KYRAREPVTKAEMLGSVVGNWQYFFPVIFIKASDSLQLVFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMP KTGFLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSDPACYEFL WGPRALIETSYVKVLHHMVKISGGPRISYPLLHEWALREGEE |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | MAGEA6 melanoma antigen family A, 6 [ Homo sapiens ] |
Official Symbol | MAGEA6 |
Synonyms | MAGEA6; melanoma antigen family A, 6; MAGE6; melanoma-associated antigen 6; cancer/testis antigen family 1; member 6; CT1.6; MAGE 6 antigen; melanoma antigen family A 6; melanoma associated antigen 6; MAGE-6 antigen; MAGE3B antigen; cancer/testis antigen 1.6; cancer/testis antigen family 1, member 6; MAGE3B; MAGE-3b; MGC52297; |
Gene ID | 4105 |
mRNA Refseq | NM_005363 |
Protein Refseq | NP_005354 |
MIM | 300176 |
UniProt ID | P43360 |
Chromosome Location | Xq28 |
Function | molecular_function; |
◆ Recombinant Proteins | ||
MAGEA6-30166TH | Recombinant Human MAGEA6 | +Inquiry |
MAGEA6-3419H | Recombinant Human MAGEA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGEA6-6788H | Recombinant Human Melanoma Antigen Family A, 6, His-tagged | +Inquiry |
MAGEA6-232H | Recombinant Human MAGEA6 protein, T7/His-tagged | +Inquiry |
MAGEA6-403H | Recombinant Human MAGEA6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEA6-4551HCL | Recombinant Human MAGEA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAGEA6 Products
Required fields are marked with *
My Review for All MAGEA6 Products
Required fields are marked with *
0
Inquiry Basket