Recombinant Human M6PR protein(31-100 aa), C-His-tagged

• Cat.No.: M6PR-2689H
• Product Overview: Recombinant Human M6PR protein(P20645)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 31-100 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: TCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: M6PR mannose-6-phosphate receptor (cation dependent) [ Homo sapiens ]
• Official Symbol: M6PR
• Synonyms: M6PR; mannose-6-phosphate receptor (cation dependent); cation-dependent mannose-6-phosphate receptor; Mr 46,000 Man6PR; CD Man-6-P receptor; small mannose 6-phosphate receptor; 46-kDa mannose 6-phosphate receptor; SMPR; MPR46; CD-MPR; MPR 46; MPR-46; FLJ32994
• Gene ID: 4074
• mRNA Refseq: NM_001207024
• Protein Refseq: NP_001193953
• MIM: 154540
• UniProt ID: P20645