Recombinant Human M6PR, His-tagged

• Cat.No.: M6PR-29239TH
• Product Overview: Recombinant fragment: MFPFYSCWRT GLLLLLLAVA VRESWQTEEK TCDLVGEKGK ESEKELALVK RLKPLFNKSF, corresponding to N terminal amino acids 1-60 of Human Mannose 6 Phosphate Receptor fused to a His tag, 12kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-60 a.a.
• Description: This gene encodes a member of the P-type lectin family. P-type lectins play a critical role in lysosome function through the specific transport of mannose-6-phosphate-containing acid hydrolases from the Golgi complex to lysosomes. The encoded protein functions as a homodimer and requires divalent cations for ligand binding. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome X.
• Conjugation: HIS
• Form: Liquid
• Storage buffer: Preservative: NoneConstituents: PBS
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSF

Gene Information

• Gene Name: M6PR mannose-6-phosphate receptor (cation dependent) [ Homo sapiens ]
• Official Symbol: M6PR
• Synonyms: M6PR; mannose-6-phosphate receptor (cation dependent); cation-dependent mannose-6-phosphate receptor
• Gene ID: 4074
• mRNA Refseq: NM_001207024
• Protein Refseq: NP_001193953
• MIM: 154540
• Uniprot ID: P20645
• Chromosome Location: 12
• Pathway: Clathrin derived vesicle budding, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Lysosome Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem
• Function: mannose binding; mannose transmembrane transporter activity; receptor activity; transmembrane signaling receptor activity