Recombinant Human LYZL6 Protein, GST-tagged

• Cat.No.: LYZL6-4528H
• Product Overview: Human LYZL6 full-length ORF ( NP_065159.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL6 is a member of a family of lysozyme-like genes (Zhang et al., 2005 [PubMed 16014814]).[supplied by OMIM
• Molecular Mass: 43.4 kDa
• AA Sequence: MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYZL6 lysozyme-like 6 [ Homo sapiens ]
• Official Symbol: LYZL6
• Synonyms: LYC1; UNQ754; PRO1485; TKAL754; LYZL6; lysozyme-like 6
• Gene ID: 57151
• mRNA Refseq: NM_020426
• Protein Refseq: NP_065159
• MIM: 612751
• UniProt ID: O75951