Recombinant Human LYZL1 Protein, GST-tagged

• Cat.No.: LYZL1-4531H
• Product Overview: Human LYZL1 full-length ORF ( AAH21730.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LYZL1 (Lysozyme Like 1) is a Protein Coding gene. GO annotations related to this gene include lysozyme activity. An important paralog of this gene is LYZL2.
• Molecular Mass: 48 kDa
• AA Sequence: MQDAPLSCLSPTRWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYZL1 lysozyme-like 1 [ Homo sapiens ]
• Official Symbol: LYZL1
• Synonyms: LYZL1; lysozyme-like 1; lysozyme-like protein 1; LYC2; MGC33408; KAAG648; PRO1278; bA534G20.1
• Gene ID: 84569
• mRNA Refseq: NM_032517
• Protein Refseq: NP_115906
• UniProt ID: Q6UWQ5