Recombinant Human LYZL1, His-tagged

• Cat.No.: LYZL1-133H
• Product Overview: Recombinant Human Lysozyme-Like Protein 1/LYZL1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys20-Ser148) of Human LYZL1 fused with a polyhistidine tag at the C-terminus.

Specification

• Description: Lysozyme-Like Protein 1 (LYZL1) is a member of the glycosyl hydrolase 22 family. Lysozymes are a family of enzymes that damage bacterial cell walls by catalyzing hydrolysis of 1,4-β-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Large amounts of lysozyme can be found in egg white. C-type lysozymes are closely related to alpha-lactalbumin in sequence and structure making them part of the same family. LYZL1 is a secreted protein and exists as a monomer.
• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: KIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCR RGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVSV DHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Protein length: 20-148 a.a.

Gene Information

• Gene Name: LYZL1 lysozyme-like 1 [ Homo sapiens ]
• Official Symbol: LYZL1
• Synonyms: LYZL1; lysozyme-like 1; lysozyme-like protein 1; LYC2; MGC33408; KAAG648; PRO1278; bA534G20.1
• Gene ID: 84569
• mRNA Refseq: NM_032517
• Protein Refseq: NP_115906
• UniProt ID: Q6UWQ5
• Chromosome Location: 10p12.1
• Function: hydrolase activity, acting on glycosyl bonds; lysozyme activity