Recombinant Human LYRM4 Protein, GST-tagged

• Cat.No.: LYRM4-4540H
• Product Overview: Human LYRM4 full-length ORF (AAH09552.1, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis. [provided by RefSeq, Sep 2016]
• Molecular Mass: 36.41 kDa
• AA Sequence: MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYRM4 LYR motif containing 4 [ Homo sapiens ]
• Official Symbol: LYRM4
• Synonyms: LYRM4; LYR motif containing 4; C6orf149, chromosome 6 open reading frame 149; LYR motif-containing protein 4; CGI 203; ISD11; homolog of yeast Isd11; mitochondrial matrix Nfs1 interacting protein; CGI-203; C6orf149
• Gene ID: 57128
• mRNA Refseq: NM_001164840
• Protein Refseq: NP_001158312
• MIM: 613311
• UniProt ID: Q9HD34