Recombinant Full Length Human LYRM4 Protein, GST-tagged

Cat.No. : LYRM4-6032HF
Product Overview : Human LYRM4 full-length ORF (AAH09552.1, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 91 amino acids
Description : The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis. [provided by RefSeq, Sep 2016]
Molecular Mass : 36.41 kDa
AA Sequence : MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYRM4 LYR motif containing 4 [ Homo sapiens ]
Official Symbol LYRM4
Synonyms LYRM4; LYR motif containing 4; C6orf149, chromosome 6 open reading frame 149; LYR motif-containing protein 4; CGI 203; ISD11; homolog of yeast Isd11; mitochondrial matrix Nfs1 interacting protein; CGI-203; C6orf149;
Gene ID 57128
mRNA Refseq NM_001164840
Protein Refseq NP_001158312
MIM 613311
UniProt ID Q9HD34

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LYRM4 Products

Required fields are marked with *

My Review for All LYRM4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon