Recombinant Human LYPLA1 Protein, His-tagged

Cat.No. : LYPLA1-308H
Product Overview : Recombinant Human LYPLA1 fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : THis gene encodes a member of the alpha/beta hydrolase superfamily. The encoded protein functions as a homodimer, exhibiting both depalmitoylating as well as lysophospholipase activity, and may be involved in Ras localization and signaling. Alternate splicing results in multiple transcript variants. Pseudogenes of tHis gene have been defined on chromosomes 4, 6, and 7.
Form : Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0
Molecular Mass : 26.8kD
AA Sequence : MGSSHHHHHHSSGLVPRGSHMCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name LYPLA1 lysophospholipase I [ Homo sapiens ]
Official Symbol LYPLA1
Synonyms LYPLA1; lysophospholipase I; acyl-protein thioesterase 1; LPL1; LPL-I; lysoPLA I; lysophospholipase 1; acyl-protein thioesterase-1; lysophospholipid-specific lysophospholipase; APT-1; hAPT1; LYSOPLA;
Gene ID 10434
mRNA Refseq NM_006330
Protein Refseq NP_006321
MIM 605599
UniProt ID O75608

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LYPLA1 Products

Required fields are marked with *

My Review for All LYPLA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon