Recombinant Human LYPD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LYPD2-3045H
Product Overview : LYPD2 MS Standard C13 and N15-labeled recombinant protein (NP_991108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Nucleotidyltransferase that act as a non-canonical poly(A) RNA polymerase which enhances mRNA stability and gene expression. Mainly targets mRNAs encoding endoplasmic reticulum-targeted protein and may be involved in induction of cell death.
Molecular Mass : 13.1 kDa
AA Sequence : MRGTQLVLLALVLAACGELAPALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIVYPFQGDSTVTKSCASKCKPSDVDGIGQTLPVSCCNTELCNVDGAPALNSLHCGALTLLPLLSLRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LYPD2 LY6/PLAUR domain containing 2 [ Homo sapiens (human) ]
Official Symbol LYPD2
Synonyms LYPD2; LY6/PLAUR domain containing 2; LYPDC2; UNQ430; ly6/PLAUR domain-containing protein 2; RGTR430
Gene ID 137797
mRNA Refseq NM_205545
Protein Refseq NP_991108
UniProt ID Q6UXB3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LYPD2 Products

Required fields are marked with *

My Review for All LYPD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon