Recombinant Human LYPD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LYPD2-3045H
• Product Overview: LYPD2 MS Standard C13 and N15-labeled recombinant protein (NP_991108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Nucleotidyltransferase that act as a non-canonical poly(A) RNA polymerase which enhances mRNA stability and gene expression. Mainly targets mRNAs encoding endoplasmic reticulum-targeted protein and may be involved in induction of cell death.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13.1 kDa
• AA Sequence: MRGTQLVLLALVLAACGELAPALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIVYPFQGDSTVTKSCASKCKPSDVDGIGQTLPVSCCNTELCNVDGAPALNSLHCGALTLLPLLSLRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LYPD2 LY6/PLAUR domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: LYPD2
• Synonyms: LYPD2; LY6/PLAUR domain containing 2; LYPDC2; UNQ430; ly6/PLAUR domain-containing protein 2; RGTR430
• Gene ID: 137797
• mRNA Refseq: NM_205545
• Protein Refseq: NP_991108
• UniProt ID: Q6UXB3