Recombinant Human LYPD2 protein, GST-tagged
Cat.No. : | LYPD2-3701H |
Product Overview : | Recombinant Human LYPD2 protein(23-102 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 23-102 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | ALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIVYPFQGDSTVTKSCASKCKPSDVDGIGQTLPVSCCNTELCNV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LYPD2 LY6/PLAUR domain containing 2 [ Homo sapiens ] |
Official Symbol | LYPD2 |
Synonyms | LYPDC2; UNQ430 |
Gene ID | 137797 |
mRNA Refseq | NM_205545.1 |
Protein Refseq | NP_991108.1 |
UniProt ID | Q6UXB3 |
◆ Recombinant Proteins | ||
LYPD2-3045H | Recombinant Human LYPD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LYPD2-3701H | Recombinant Human LYPD2 protein, GST-tagged | +Inquiry |
Lypd2-3878M | Recombinant Mouse Lypd2 Protein, Myc/DDK-tagged | +Inquiry |
LYPD2-9389M | Recombinant Mouse LYPD2 Protein | +Inquiry |
LYPD2-1333H | Recombinant Human LYPD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPD2-4591HCL | Recombinant Human LYPD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LYPD2 Products
Required fields are marked with *
My Review for All LYPD2 Products
Required fields are marked with *
0
Inquiry Basket