Recombinant Human LY96 protein, His-tagged

• Cat.No.: LY96-2240H
• Product Overview: Recombinant Human LY96 protein(Q9Y6Y9)(19-160aa), fused to N-terminal His tag, was expressed in Insect Cell.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 19-160aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.5 kDa
• AA Sequence: QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: LY96 lymphocyte antigen 96 [ Homo sapiens ]
• Official Symbol: LY96
• Synonyms: LY96; lymphocyte antigen 96; MD 2; protein MD-2; myeloid differentiation protein-2; MD2; MD-2; ly-96; ESOP-1
• Gene ID: 23643
• mRNA Refseq: NM_001195797
• Protein Refseq: NP_001182726
• MIM: 605243
• UniProt ID: Q9Y6Y9