Recombinant Human LY96 Protein, His-tagged

• Cat.No.: LY96-4159H
• Product Overview: Recombinant Human LY96 protein(Glu17-Asn160), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Glu17-Asn160
• Tag: N-His
• Form: Liquid in sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose.
• Molecular Mass: The protein has a calculated MW of 19 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.65 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MGSSHHHHHHHHSSGLVPRGSEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Gene Information

• Gene Name: LY96 lymphocyte antigen 96 [ Homo sapiens ]
• Official Symbol: LY96
• Synonyms: LY96; lymphocyte antigen 96; MD 2; protein MD-2; myeloid differentiation protein-2; MD2; MD-2; ly-96; ESOP-1
• Gene ID: 23643
• mRNA Refseq: NM_001195797
• Protein Refseq: NP_001182726
• MIM: 605243
• UniProt ID: Q9Y6Y9