Recombinant Human LY96, GST-tagged

• Cat.No.: LY96-154H
• Product Overview: Recombinant Human LY96(19 a.a. - 160 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Molecular Mass: 41.36 kDa
• AA Sequence: QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEV ICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LY96 lymphocyte antigen 96 [ Homo sapiens ]
• Official Symbol: LY96
• Synonyms: LY96; lymphocyte antigen 96; MD2; MD-2; ly-96; ESOP-1; myeloid differentiation protein-2; MD-2 protein; protein MD-2
• Gene ID: 23643
• mRNA Refseq: NM_015364
• Protein Refseq: NP_056179
• MIM: 605243
• UniProt ID: Q9Y6Y9
• Chromosome Location: 8q21.11
• Pathway: Pathogenic Escherichia coli infection; Toll-like receptor signaling pathway; Signaling in Immune system
• Function: coreceptor activity; lipopolysaccharide receptor activity; protein binding