Recombinant Human LTBR Protein, GST-tagged

Description :	The protein encoded by this gene is a member of the tumor necrosis factor (TNF) family of receptors. It is expressed on the surface of most cell types, including cells of epithelial and myeloid lineages, but not on T and B lymphocytes. The protein specifically binds the lymphotoxin membrane form (a complex of lymphotoxin-alpha and lymphtoxin-beta). The encoded protein and its ligand play a role in the development and organization of lymphoid tissue and tranformed cells. Activation of the encoded protein can trigger apoptosis. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	70.29 kDa
AA Sequence :	QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	LTBR lymphotoxin beta receptor (TNFR superfamily, member 3) [ Homo sapiens ]
Official Symbol	LTBR
Synonyms	LTBR; lymphotoxin beta receptor (TNFR superfamily, member 3); D12S370; tumor necrosis factor receptor superfamily member 3; TNF R III; TNFCR; TNFR RP; TNFR2 RP; TNFRSF3; TNF-RIII; TNFR-III; lymphotoxin B receptor; lymphotoxin-beta receptor; TNFR superfamily, member 3; tumor necrosis factor C receptor; tumor necrosis factor receptor type III; tumor necrosis factor receptor 2-related protein; tumor necrosis factor receptor superfamily, member 3; CD18; TNFR-RP; TNFR2-RP; LT-BETA-R; TNF-R-III;
Gene ID	4055
mRNA Refseq	NM_002342
Protein Refseq	NP_002333
MIM	600979
UniProt ID	P36941