Recombinant Human LTA, StrepII-tagged

• Cat.No.: LTA-221H
• Product Overview: Purified, full-length human recombinant Lymphotoxin-alpha LTA (TNFb) protein (amino acids 35-205, 171 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 19.4 kDa. (Accession NP_00116.2; UniProt P01374)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 35-205, 171 a.a.
• Description: LTA is a cytokine that, in its homotrimeric form, binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form, it binds with LTB to TNFRSF3/LTBR. Lymphotoxins are produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFV YSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTH TDGIPHLVLSPSTVFFGAFAL
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ]
• Official Symbol: LTA
• Synonyms: LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1
• Gene ID: 4049
• mRNA Refseq: NM_000595
• Protein Refseq: NP_000586
• MIM: 153440
• UniProt ID: P01374
• Chromosome Location: 6p21.3
• Pathway: Apoptosis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem
• Function: cytokine activity; receptor binding; tumor necrosis factor receptor binding