Recombinant Human LST1 protein, His-tagged
Cat.No. : | LST1-3186H |
Product Overview : | Recombinant Human LST1 protein(O00453)(1-66aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-66aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 11.5 kDa |
AA Sequence : | MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LST1 Leukocyte-specific transcript 1 [ Homo sapiens ] |
Official Symbol | LST1 |
Synonyms | LST1; Leukocyte-specific transcript 1; |
Gene ID | 7929 |
◆ Recombinant Proteins | ||
LST1-662H | Recombinant Human LST1 protein, GST-tagged | +Inquiry |
RFL5699MF | Recombinant Full Length Mouse Leukocyte-Specific Transcript 1 Protein(Lst1) Protein, His-Tagged | +Inquiry |
LST1-2588R | Recombinant Rhesus monkey LST1 Protein, His-tagged | +Inquiry |
LST1-3186H | Recombinant Human LST1 protein, His-tagged | +Inquiry |
LST1-661H | Recombinant Human LST1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LST1-9168HCL | Recombinant Human LST1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LST1 Products
Required fields are marked with *
My Review for All LST1 Products
Required fields are marked with *
0
Inquiry Basket