Recombinant Human LST1 protein, GST-tagged
Cat.No. : | LST1-662H |
Product Overview : | Recombinant Human LST1(1 a.a. - 118 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 118 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 39.8 kDa |
AA Sequence : | MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWPRAPQSRNSTMHLCRGCQCPAVRDLTSGAE TREAPRRIQELTMPALLRTNPPEHPRHLPQPRRVDRVPLWSSQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | LST1 Leukocyte-specific transcript 1 [ Homo sapiens ] |
Official Symbol | LST1 |
Synonyms | LST1; Leukocyte-specific transcript 1; |
Gene ID | 7940 |
mRNA Refseq | NM_007161 |
Protein Refseq | NP_009092 |
MIM | 109170 |
UniProt ID | O00453 |
Chromosome Location | 6p21.3 |
◆ Recombinant Proteins | ||
LST1-663H | Recombinant Human LST1 protein, MYC/DDK-tagged | +Inquiry |
LST1-2408R | Recombinant Rhesus Macaque LST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL5699MF | Recombinant Full Length Mouse Leukocyte-Specific Transcript 1 Protein(Lst1) Protein, His-Tagged | +Inquiry |
LST1-3186H | Recombinant Human LST1 protein, His-tagged | +Inquiry |
LST1-618HF | Recombinant Full Length Human LST1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LST1-9168HCL | Recombinant Human LST1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LST1 Products
Required fields are marked with *
My Review for All LST1 Products
Required fields are marked with *
0
Inquiry Basket