Recombinant Human LSS Protein, GST-tagged

• Cat.No.: LSS-4600H
• Product Overview: Human LSS partial ORF ( NP_001001438.1, 633 a.a. - 732 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Alternative splicing results in multiple transcript variants encoding different isoforms
• Molecular Mass: 36.74 kDa
• AA Sequence: FESCEERRYLQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLYPERALAGHP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LSS lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) [ Homo sapiens ]
• Official Symbol: LSS
• Synonyms: LSS; lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase); lanosterol synthase; OSC; hOSC; oxidosqualene--lanosterol cyclase; 2,3-epoxysqualene-lanosterol cyclase; 2,3-epoxysqualene--lanosterol cyclase; FLJ25486; FLJ35015; FLJ39450; FLJ46393
• Gene ID: 4047
• mRNA Refseq: NM_001001438
• Protein Refseq: NP_001001438
• MIM: 600909
• UniProt ID: P48449