Recombinant Full Length Human LSS Protein, C-Flag-tagged
Cat.No. : | LSS-1516HFL |
Product Overview : | Recombinant Full Length Human LSS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 83.1 kDa |
AA Sequence : | MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDTKNYFKDLPKA HTAFEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIPLPAGYREEIVRYLRSVQLPDGG WGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARNILHKKGGAVAIPSWGKFWLAVLNVYSWEGLNT LFPEMWLFPDWAPAHPSTLWCHCRQVYLPMSYCYAVRLSAAEDPLVQSLRQELYVEDFASIDWLAQRNNV APDELYTPHSWLLRVVYALLNLYEHHHSAHLRQRAVQKLYEHIVADDRFTKSISIGPISKTINMLVRWYV DGPASTAFQEHVSRIPDYLWMGLDGMKMQGTNGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRL SQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVL LNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAAEIRETL TQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACDFLLSRQMADGGWG EDFESCEERRYLQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSC AISYTSYRNIFPIWALGRFSQLYPERALAGHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Steroid biosynthesis |
Full Length : | Full L. |
Gene Name | LSS lanosterol synthase [ Homo sapiens (human) ] |
Official Symbol | LSS |
Synonyms | OSC; APMR4; HYPT14; CTRCT44 |
Gene ID | 4047 |
mRNA Refseq | NM_001001438.3 |
Protein Refseq | NP_001001438.1 |
MIM | 600909 |
UniProt ID | P48449 |
◆ Recombinant Proteins | ||
USP30-6132R | Recombinant Rat USP30 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSX4-2975H | Recombinant Human SSX4, GST-tagged | +Inquiry |
NSG1-2310H | Recombinant Human NSG1 Protein, GST-tagged | +Inquiry |
AYP1020-RS08990-5964S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS08990 protein, His-tagged | +Inquiry |
EFCAB14-1197H | Recombinant Human EFCAB14 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
C-type lectin like protein-040H | Native Hen C-type lectin like protein Protein | +Inquiry |
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
PGC-132H | Native Human Pepsinogen II | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-1424HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
EPHA2-001HCL | Recombinant Human EPHA2 cell lysate | +Inquiry |
PCYT1B-1319HCL | Recombinant Human PCYT1B cell lysate | +Inquiry |
Lung-307H | Human Lung (Pulmonary embolism) Lysate | +Inquiry |
DNAJC18-496HCL | Recombinant Human DNAJC18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LSS Products
Required fields are marked with *
My Review for All LSS Products
Required fields are marked with *
0
Inquiry Basket