Recombinant Human LSP1

• Cat.No.: LSP1-29147TH
• Product Overview: Recombinant fragment corresponding to amino acids 240-338 of Human LSP1 with an N terminal proprietary tag, Predicted MWt 36.52 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Molecular Weight: 36.520kDa inclusive of tags
• Tissue specificity: Activated T-lymphocytes.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA

Gene Information

• Gene Name: LSP1 lymphocyte-specific protein 1 [ Homo sapiens ]
• Official Symbol: LSP1
• Synonyms: LSP1; lymphocyte-specific protein 1; WP34
• Gene ID: 4046
• mRNA Refseq: NM_001013253
• Protein Refseq: NP_001013271
• MIM: 153432
• Uniprot ID: P33241
• Chromosome Location: 11p15.5
• Pathway: Tuberculosis, organism-specific biosystem; Tuberculosis, conserved biosystem; p38 signaling mediated by MAPKAP kinases, organism-specific biosystem
• Function: actin binding; signal transducer activity