Recombinant Human LSP1 Protein, GST-tagged

• Cat.No.: LSP1-4602H
• Product Overview: Human LSP1 partial ORF ( NP_002330.1, 240 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LSP1 lymphocyte-specific protein 1 [ Homo sapiens ]
• Official Symbol: LSP1
• Synonyms: LSP1; lymphocyte-specific protein 1; WP34; 52 kDa phosphoprotein; 47 kDa actin binding protein; 47 kDa actin-binding protein; leukocyte-specific protein 1; lymphocyte-specific antigen WP34; leufactin (leukocyte F-actin binding protein); F-actin binding and cytoskeleton associated protein; pp52
• Gene ID: 4046
• mRNA Refseq: NM_001013253
• Protein Refseq: NP_001013271
• MIM: 153432
• UniProt ID: P33241