Recombinant Human LSMEM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LSMEM1-5780H
• Product Overview: C7orf53 MS Standard C13 and N15-labeled recombinant protein (NP_872403) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: LSMEM1 (Leucine Rich Single-Pass Membrane Protein 1) is a Protein Coding gene.
• Molecular Mass: 14.3 kDa
• AA Sequence: MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIVLIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LSMEM1 leucine rich single-pass membrane protein 1 [ Homo sapiens (human) ]
• Official Symbol: LSMEM1
• Synonyms: LSMEM1; leucine rich single-pass membrane protein 1; C7orf53; leucine-rich single-pass membrane protein 1
• Gene ID: 286006
• mRNA Refseq: NM_182597
• Protein Refseq: NP_872403
• UniProt ID: Q8N8F7