Recombinant Human LSM5 Protein, GST-tagged

• Cat.No.: LSM5-4606H
• Product Overview: Human LSM5 full-length ORF ( AAH05938, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM
• Molecular Mass: 35.75 kDa
• AA Sequence: MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LSM5 LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: LSM5
• Synonyms: LSM5; LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm5; YER146W; FLJ12710
• Gene ID: 23658
• mRNA Refseq: NM_001130710
• Protein Refseq: NP_001124182
• MIM: 607285
• UniProt ID: Q9Y4Y9