Recombinant Full Length Human LSM5 Protein, GST-tagged
Cat.No. : | LSM5-5999HF |
Product Overview : | Human LSM5 full-length ORF ( AAH05938, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 91 amino acids |
Description : | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM |
Molecular Mass : | 35.75 kDa |
AA Sequence : | MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LSM5 LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | LSM5 |
Synonyms | LSM5; LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm5; YER146W; FLJ12710; |
Gene ID | 23658 |
mRNA Refseq | NM_001130710 |
Protein Refseq | NP_001124182 |
MIM | 607285 |
UniProt ID | Q9Y4Y9 |
◆ Recombinant Proteins | ||
LSM5-5227M | Recombinant Mouse LSM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
LSM5-293H | Recombinant Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae), His-tagged | +Inquiry |
LSM5-5643C | Recombinant Chicken LSM5 | +Inquiry |
LSM5-9334M | Recombinant Mouse LSM5 Protein | +Inquiry |
LSM5-2585R | Recombinant Rhesus monkey LSM5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM5-9172HCL | Recombinant Human LSM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LSM5 Products
Required fields are marked with *
My Review for All LSM5 Products
Required fields are marked with *
0
Inquiry Basket