Recombinant Human LRRN2, His-tagged

• Cat.No.: LRRN2-29432TH
• Product Overview: Recombinant fragment, corresponding to amino acids 333-549 of Human LRRN5 with N terminal His tag; MWt 25 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 333-549 a.a.
• Description: The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas. The encoded protein has homology with other proteins that function as cell-adhesion molecules or as signal transduction receptors and is a candidate for the target gene in the 1q32.1 amplicon in malignant gliomas. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 115 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: HLPQMETLMLNNNALSALHQQTVESLPNLQEVGLHGNPIR CDCVIRWANATGTRVRFIEPQSTLCAEPPDLQRLPVRE VPFREMTDHCLPLISPRSFPPSLQVASGESMVLHCRAL AEPEPEIYWVTPAGLRLTPAHAGRRYRVYPEGTLELRRVTAEEAGLYTCVAQNLVGADTKTVSVVVGRALLQPGRDEG QGLELRVQETHPYHILLSWVTPP

Gene Information

• Gene Name: LRRN2 leucine rich repeat neuronal 2 [ Homo sapiens ]
• Official Symbol: LRRN2
• Synonyms: LRRN2; leucine rich repeat neuronal 2; leucine rich repeat neuronal 5 , LRRN5; leucine-rich repeat neuronal protein 2; fibronectin type III; immunoglobulin and leucine rich repeat domain 7; FIGLER7; GAC1; leucine rich and ankyrin repeats 1; LRANK1
• Gene ID: 10446
• mRNA Refseq: NM_006338
• Protein Refseq: NP_006329
• MIM: 605492
• Uniprot ID: O75325
• Chromosome Location: 1q32.1
• Function: receptor activity