Recombinant Human LRRN2, His-tagged

Cat.No. : LRRN2-29432TH
Product Overview : Recombinant fragment, corresponding to amino acids 333-549 of Human LRRN5 with N terminal His tag; MWt 25 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 333-549 a.a.
Description : The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas. The encoded protein has homology with other proteins that function as cell-adhesion molecules or as signal transduction receptors and is a candidate for the target gene in the 1q32.1 amplicon in malignant gliomas. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 115 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HLPQMETLMLNNNALSALHQQTVESLPNLQEVGLHGNPIR CDCVIRWANATGTRVRFIEPQSTLCAEPPDLQRLPVRE VPFREMTDHCLPLISPRSFPPSLQVASGESMVLHCRAL AEPEPEIYWVTPAGLRLTPAHAGRRYRVYPEGTLELRRVTAEEAGLYTCVAQNLVGADTKTVSVVVGRALLQPGRDEG QGLELRVQETHPYHILLSWVTPP
Gene Name LRRN2 leucine rich repeat neuronal 2 [ Homo sapiens ]
Official Symbol LRRN2
Synonyms LRRN2; leucine rich repeat neuronal 2; leucine rich repeat neuronal 5 , LRRN5; leucine-rich repeat neuronal protein 2; fibronectin type III; immunoglobulin and leucine rich repeat domain 7; FIGLER7; GAC1; leucine rich and ankyrin repeats 1; LRANK1;
Gene ID 10446
mRNA Refseq NM_006338
Protein Refseq NP_006329
MIM 605492
Uniprot ID O75325
Chromosome Location 1q32.1
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LRRN2 Products

Required fields are marked with *

My Review for All LRRN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon