Recombinant Human LRRC57 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LRRC57-2452H
• Product Overview: LRRC57 MS Standard C13 and N15-labeled recombinant protein (NP_694992) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: LRRC57 (Leucine Rich Repeat Containing 57) is a Protein Coding gene. An important paralog of this gene is ENSG00000285942.
• Molecular Mass: 26.6 kDa
• AA Sequence: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LRRC57 leucine rich repeat containing 57 [ Homo sapiens (human) ]
• Official Symbol: LRRC57
• Synonyms: LRRC57; leucine rich repeat containing 57; leucine-rich repeat-containing protein 57; FLJ36812; DKFZp686H1865
• Gene ID: 255252
• mRNA Refseq: NM_153260
• Protein Refseq: NP_694992
• UniProt ID: Q8N9N7